PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01201g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 143aa    MW: 15937 Da    PI: 8.8655
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01201g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.33e-161259249
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              +i  ++ r vtfskRr+g++KK +EL  +++a va ++fs+tgk y+ 
  Peinf101Scf01201g00004.1 12 QIVKETSRMVTFSKRRKGLFKKSSELESMTGAHVAAVVFSPTGKPYTH 59
                              6778999*************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-19362IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.549363IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-20468IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-15525IPR002100Transcription factor, MADS-box
PfamPF003193.5E-211358IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-152540IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-154061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MGTGKKKIEI KQIVKETSRM VTFSKRRKGL FKKSSELESM TGAHVAAVVF SPTGKPYTHG  60
NVSSAIERHF SSSTSENDVC SDSSGSRSSM HSANCLYKWL EDIKVDECQN LNQLLLLKEQ  120
LEGTKENLAS NIQDSQTFEA LFR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796162.15e-56PREDICTED: MADS-box transcription factor 23-like
RefseqXP_016514484.12e-55PREDICTED: MADS-box transcription factor 23-like
TrEMBLK4B0J47e-51K4B0J4_SOLLC; Uncharacterized protein
STRINGSolyc01g098070.1.12e-50(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23371757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-14AGAMOUS-like 29